PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.02G140000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family SRS
Protein Properties Length: 352aa    MW: 36498.9 Da    PI: 7.5965
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.02G140000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702219.28.9e-681322913153
               DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstkls 92 
                          sgt++CqdCGnqakkdC+++RCRtCCksrg+dC+thvkstWvpaa+rrerq ++aaa   + +s ++   k++r   ++++++ s+t++s
  Manes.02G140000.1.p 132 SGTTTCQDCGNQAKKDCSYRRCRTCCKSRGYDCSTHVKSTWVPAARRRERQLMAAAAGGGDGSSGSTTGIKKPRLV-NSQTTTNSHTSTS 220
                          7899************************************************999999999999999999999986.7788899999*** PP

               DUF702  93 saeskkeletss..........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                          +++++++++tss          lP +v+++avf+cvrv++vddge+e+aYq++v+igGhvfkG+LydqG+e
  Manes.02G140000.1.p 221 NTTPPRSFDTSSshqdasfketLPGNVRAQAVFKCVRVTAVDDGEDEYAYQAVVNIGGHVFKGFLYDQGVE 291
                          **********999********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051427.9E-62134291IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.6E-27136178IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.0E-29243290IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MGMFVVTPAS FNHHHQHQHE SSINLATDPI HGSNAAATAL GVGVGVGVIP LLTAAPCLAP  60
QNMDDQDLLN NGRNKMGGLQ FWQNQSSHHH TLSNIKRTNA SILDHDNSPA NLLQSGNNNS  120
SGGGIGGNSA SSGTTTCQDC GNQAKKDCSY RRCRTCCKSR GYDCSTHVKS TWVPAARRRE  180
RQLMAAAAGG GDGSSGSTTG IKKPRLVNSQ TTTNSHTSTS NTTPPRSFDT SSSHQDASFK  240
ETLPGNVRAQ AVFKCVRVTA VDDGEDEYAY QAVVNIGGHV FKGFLYDQGV EGRDGFPNIS  300
ELHLGSANSG GGGGDGVRNG ASSSPIIDPS DVYGASGGGL LGGLSYGNPI N*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002530898.11e-155PREDICTED: protein LATERAL ROOT PRIMORDIUM 1
SwissprotQ94CK91e-82LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLB9SY291e-155B9SY29_RICCO; Transcription factor, putative
STRINGPOPTR_0009s07510.11e-131(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65043351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.21e-69Lateral root primordium (LRP) protein-related